PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.08G106900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB
Protein Properties Length: 440aa    MW: 48882.1 Da    PI: 7.4992
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.08G106900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-181461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  Manes.08G106900.1.p 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                         678*******************************************97 PP

2Myb_DNA-binding445.2e-1467109145
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                          rg+++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w+
  Manes.08G106900.1.p  67 RGAFSQQEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWN 109
                          89********************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.407965IPR017930Myb domain
SuperFamilySSF466891.8E-2912108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002493.3E-161461IPR001005SANT/Myb domain
CDDcd001677.74E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2465116IPR009057Homeodomain-like
SMARTSM007171.9E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129419.52766116IPR017930Myb domain
PfamPF002496.2E-1367109IPR001005SANT/Myb domain
CDDcd001677.11E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS SIKKKLRQRG  120
IDPNTHKPLS EVENDKEKQL ANSKNNEKAS FISNNELNLI ETANSKPSTI SSSSKITSNN  180
DHSSNLTPTP STQEFFLDRY AASHESSTTS CRPSDLVGYL PFQKLSYRPN IGLSVNPNTS  240
ICFNPNSSSS EMISEFNSST TPSILPSISN SMFQTPIRVK PSVSLPSDNP SVRSCDVSGV  300
QNWEASSFSN NGSSCSNGSN SGIELQNTTT FFESNAFSWG LADCGKPGEE AQLRSLENDT  360
EDMKWSEYLS TPFLLGTAIQ NQTSQPMYSD VKPETNFITE GSSGSWQQNH QHHHQQVSQP  420
SDIYAKDLQR LAVAFGQTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ8017491e-130JQ801749.1 Populus tomentosa putative transcription factor (MYB216) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015584638.10.0PREDICTED: transcription factor MYB86
TrEMBLB9I6B70.0B9I6B7_POPTR; Uncharacterized protein
STRINGPOPTR_0013s00290.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-122myb domain protein 61